umweltFAIRaendern: Lasst tausend und einen und noch mehr Artikel blühen!

umweltFAIRaendern: Lasst tausend und einen und noch mehr Artikel blühen!

Die Anzahl der Beiträge auf umweltFAIRaendern erhöht sich “akut” um rund 1.100 Beiträge auf insgesamt jetzt etwas mehr als 3.900 Texte. Grund dafür ist die Übernahme aller Atomenergie-Texte aus dem Blog des ehemaligen Bundestagsabgeordneten Hubertus Zdebel, für den ich in fast zwei Legislaturperioden von 2014 bis 2021 als wissenschaftlicher Referent in Sachen Atomausstieg tätig war. Damit werden auf umweltFAIRaendern nun noch mehr Themen über die Atomenergie enger miteinander verknüpft. Ich hoffe, dass eröffnet nicht nur mehr Recherche-Möglichkeiten, über die politischen, wirtschaftlichen, rechtlichen und technischen Aktivitäten der Atomenergie und der damit verbundenen nuklearen Gefahren für Umwelt und Demokratie. Diese “Anreicherung” dürfte auch beitragen, ein noch genaueres Bild zur Geschichte der Anti-Atom-Bewegung und den Gründen, warum in der Bundesrepublik und Westdeutschland, der Atomausstieg auch als Beitrag zur Demokratie-Bewegung in den kapitalistischen-marktwirtschaftlichen Staaten von Bedeutung war und ist. Für viele Recherchen – auch mit Blick auf die Arbeit des deutschen Bundestages und den Umgangsweisen der Bundesregierungen in den letzten Jahren stellt umweltFAIRaendern noch mehr Informationen und Hintergrund bereit. Wie ihr diese Arbeit unterstützen könntet (werbt für diesen Blog in euren Kreisen!), damit wir morgen noch kraftvoll zubeißen können? Aber fragt ruhig!

  • Siehe auch die Homepage Hubertus Zdebel. Hier findet ihr jetzt alle Beiträge von der Seite unter der Kategorie Atom-BT. Das wird demnächst auch im Menü noch nachgetragen.
  • Wichtig: Der Import der Beiträge hat noch diverse Probleme, sodass nicht immer alles bequem funktioniert. Aber: Alles Daten – z.B. die weiterführenden PDF-Dateien etc. befinden sich nun in der Mediathek auf umweltFAIRaendern als Duplikat. Wenn der Link noch auf die Seite von Zdebel zeigt, dort aber nichts zu finden ist, einfach den Link kopieren, die Domain-Angaben zu umweltFAIRaendern korrigieren. Dann müsste es klappen. Gern auch Feedback, wo es Probleme gibt.

* Tragt euch in die NEWS|Info Liste ein, wenn ihr weiterhin kostenlos von umweltFAIRaendern informiert werden wollt, was in Sachen Atomenergie zwischen nuklearem Risiko und wirtschaftlich-politischen Interessen, über Hintergründe und Zusammenhänge erfahren wollt. So bleibt ihr in jedem Fall aus erster Hand informiert.

*Erstveröffentlichung beim ehemaligen MdB www.Hubertus-Zdebel.de.
Print Friendly, PDF & Email

Dirk Seifert

%d Bloggern gefällt das: